Lineage for d5chtb_ (5cht B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2173267Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2173268Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2174174Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2174175Protein automated matches [190230] (20 species)
    not a true protein
  7. 2174277Species Mus musculus [TaxId:10090] [318905] (2 PDB entries)
  8. 2174279Domain d5chtb_: 5cht B: [318978]
    Other proteins in same PDB: d5chta2
    automated match to d2ibia1
    complexed with zn

Details for d5chtb_

PDB Entry: 5cht (more details), 2.8 Å

PDB Description: crystal structure of usp18
PDB Compounds: (B:) Ubl carboxyl-terminal hydrolase 18

SCOPe Domain Sequences for d5chtb_:

Sequence, based on SEQRES records: (download)

>d5chtb_ d.3.1.0 (B:) automated matches {Mus musculus [TaxId: 10090]}
phglvglhnigqtcclnsllqvfmmnmdfrmilkritvprsaeerkrsvpfqlllllekm
qdsrqkavlptelvqclqkynvplfvqhdaaqlyltiwnltkdqitdtdlterlqglfti
wtqeslicvgctaessrrsklltlslplfdkdakplktledalrcfvqpkelassdmcce
scgektpwkqvlklthlpqtltihlmrfsarnsrtekichsvnfpqsldfsqvlpteedl
gdtkeqseihyelfaviahvgmadfghycayirnpvdgkwfcfndshvcwvtwkdvqcty
gnhryrwretayllvytkt

Sequence, based on observed residues (ATOM records): (download)

>d5chtb_ d.3.1.0 (B:) automated matches {Mus musculus [TaxId: 10090]}
phglvglhnigqtcclnsllqvfmmnmdfrmilkritvprsaeerkrsvpfqlllllekm
qdsrqkavlptelvqclqkynvplfvqhdaaqlyltiwnltkdqitdtdlterlqglfti
wtqeslicvgctaessrrsklltlslplfdkdakplktledalrcfvqpkelassdmcce
scgektpwkqvlklthlpqtltihlmrfstekichsvnfpqsldfsqveihyelfaviah
vgmadfghycayirnpvdgkwfcfndshvcwvtwkdvqctygnhryrwretayllvytkt

SCOPe Domain Coordinates for d5chtb_:

Click to download the PDB-style file with coordinates for d5chtb_.
(The format of our PDB-style files is described here.)

Timeline for d5chtb_: