SCOP 1.69: Domain d2aky_1: 2aky 3-130,169-220

Lineage for d2aky_1 (2aky 3-130,169-220)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (17 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Adenylate kinase [52554] (13 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52559] (4 PDB entries)
   contains a rudiment "zinc-finger" subdomain, residue 131-168

8. Domain d2aky_1: 2aky 3-130,169-220 [31897]
   Other proteins in same PDB: d2aky_2

Details for d2aky_1

PDB Entry: 2aky, 1.96 Å

PDB Description: high-resolution structures of adenylate kinase from yeast ligated with inhibitor ap5a, showing the pathway of phosphoryl transfer

SCOP Domain Sequences for d2aky_1:

Sequence; same for both SEQRES and ATOM records:

>d2aky_1 c.37.1.1 (3-130,169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae)}
esirmvligppgagkgtqapnlqerfhaahlatgdmlrsqiakgtqlgleakkimdqggl
vsddimvnmikdeltnnpackngfildgfprtipqaekldqmlkeqgtplekaielkvdd
ellvaritXnadalkkrlaayhaqtepivdfykktgiwagvdasqppatvwadilnklgk
n

Timeline for d2aky_1:

• d2aky_1 first appeared (with stable ids) in SCOP 1.55
  
• d2aky_1 appears in SCOP 1.67
  
• d2aky_1 appears in SCOP 1.71
  
• d2aky_1 appears in the current release, SCOPe 2.08, called d2akya1