Lineage for d2akya1 (2aky A:3-130,A:169-220)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2865690Protein Adenylate kinase [52554] (16 species)
  7. 2865699Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52559] (4 PDB entries)
    contains a rudiment "zinc-finger" subdomain, residue 131-168
  8. 2865701Domain d2akya1: 2aky A:3-130,A:169-220 [31897]
    Other proteins in same PDB: d2akya2
    complexed with ap5, mg

Details for d2akya1

PDB Entry: 2aky (more details), 1.96 Å

PDB Description: high-resolution structures of adenylate kinase from yeast ligated with inhibitor ap5a, showing the pathway of phosphoryl transfer
PDB Compounds: (A:) adenylate kinase

SCOPe Domain Sequences for d2akya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
esirmvligppgagkgtqapnlqerfhaahlatgdmlrsqiakgtqlgleakkimdqggl
vsddimvnmikdeltnnpackngfildgfprtipqaekldqmlkeqgtplekaielkvdd
ellvaritXnadalkkrlaayhaqtepivdfykktgiwagvdasqppatvwadilnklgk
n

SCOPe Domain Coordinates for d2akya1:

Click to download the PDB-style file with coordinates for d2akya1.
(The format of our PDB-style files is described here.)

Timeline for d2akya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2akya2