Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.4: Link domain [56477] (3 proteins) |
Protein automated matches [190733] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187906] (31 PDB entries) |
Domain d5bzea1: 5bze A:25-173 [318965] Other proteins in same PDB: d5bzea2 automated match to d4pz4a_ complexed with 68n, 6bt, dms, so4 |
PDB Entry: 5bze (more details), 1.31 Å
SCOPe Domain Sequences for d5bzea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bzea1 d.169.1.4 (A:25-173) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qidlnvtcryagvfhvekngrysisrteaadlcqafnstlptmdqmklalskgfetcryg fiegnvviprihpnaicaanhtgvyilvtsntshydtycfnasappeedctsvtdlpnsf dgpvtitivnrdgtryskkgeyrthqedi
Timeline for d5bzea1: