Lineage for d1aky_1 (1aky 3-130,169-220)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581394Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (18 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 581395Protein Adenylate kinase [52554] (14 species)
  7. 581419Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52559] (4 PDB entries)
    contains a rudiment "zinc-finger" subdomain, residue 131-168
  8. 581420Domain d1aky_1: 1aky 3-130,169-220 [31896]
    Other proteins in same PDB: d1aky_2
    complexed with ap5, imd

Details for d1aky_1

PDB Entry: 1aky (more details), 1.63 Å

PDB Description: high-resolution structures of adenylate kinase from yeast ligated with inhibitor ap5a, showing the pathway of phosphoryl transfer

SCOP Domain Sequences for d1aky_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aky_1 c.37.1.1 (3-130,169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae)}
esirmvligppgagkgtqapnlqerfhaahlatgdmlrsqiakgtqlgleakkimdqggl
vsddimvnmikdeltnnpackngfildgfprtipqaekldqmlkeqgtplekaielkvdd
ellvaritXnadalkkrlaayhaqtepivdfykktgiwagvdasqppatvwadilnklgk
n

SCOP Domain Coordinates for d1aky_1:

Click to download the PDB-style file with coordinates for d1aky_1.
(The format of our PDB-style files is described here.)

Timeline for d1aky_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aky_2