SCOPe 2.08: Domain d5a5kl2: 5a5k L:87-212

Lineage for d5a5kl2 (5a5k L:87-212)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (14 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [318877] (4 PDB entries)

8. Domain d5a5kl2: 5a5k L:87-212 [318955]
   Other proteins in same PDB: d5a5ka1, d5a5kb1, d5a5kc1, d5a5kd1, d5a5ke1, d5a5kf1, d5a5kg1, d5a5kh1, d5a5ki1, d5a5kj1, d5a5kk1, d5a5kl1, d5a5km1, d5a5kn1, d5a5ko1, d5a5kp1, d5a5kq1, d5a5kr1, d5a5ks1, d5a5kt1, d5a5ku1, d5a5kv1, d5a5kw1, d5a5kx1
   automated match to d1gnwa1
   complexed with 7wb

Details for d5a5kl2

PDB Entry: 5a5k, 2.77 Å

PDB Description: atgstf2 from arabidopsis thaliana in complex with camalexin

PDB Compounds: (L:) glutathione s-transferase f2

SCOPe Domain Sequences for d5a5kl2:

Sequence; same for both SEQRES and ATOM records:

>d5a5kl2 a.45.1.1 (L:87-212) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lqtdsknisqyaimaigmqvedhqfdpvasklafeqifksiyglttdeavvaeeeaklak
vldvyearlkefkylagetftltdlhhipaiqyllgtptkklfterprvnewvaeitkrp
asekvq

Timeline for d5a5kl2:

• d5a5kl2 first appeared in SCOPe 2.06
  
• d5a5kl2 appears in SCOPe 2.07