Lineage for d5choa_ (5cho A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794132Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2794133Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2794356Family b.45.1.0: automated matches [191365] (1 protein)
    not a true family
  6. 2794357Protein automated matches [190439] (22 species)
    not a true protein
  7. 2794439Species Uncultured bacterium [TaxId:77133] [318898] (1 PDB entry)
  8. 2794440Domain d5choa_: 5cho A: [318940]
    automated match to d4hx6e_
    complexed with fad

Details for d5choa_

PDB Entry: 5cho (more details), 2.37 Å

PDB Description: crystal structure of borf, the flavin reductase component of a bacterial two-component tryptophan halogenase
PDB Compounds: (A:) flavin reductase

SCOPe Domain Sequences for d5choa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5choa_ b.45.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}
llrdsrslrgifssfatgvtvvtvggdsphamtansftsvsldpplilvcvecdaamhgs
llevgsfgvsvlaadqqhvallyanrwrprdptqfdrpgwargartgaplargalawfec
alwraydagdhsifvgrlltaerhdrrdalvyhsgqfrglpdrap

SCOPe Domain Coordinates for d5choa_:

Click to download the PDB-style file with coordinates for d5choa_.
(The format of our PDB-style files is described here.)

Timeline for d5choa_: