Class b: All beta proteins [48724] (180 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.0: automated matches [191365] (1 protein) not a true family |
Protein automated matches [190439] (22 species) not a true protein |
Species Uncultured bacterium [TaxId:77133] [318898] (1 PDB entry) |
Domain d5choa_: 5cho A: [318940] automated match to d4hx6e_ complexed with fad |
PDB Entry: 5cho (more details), 2.37 Å
SCOPe Domain Sequences for d5choa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5choa_ b.45.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]} llrdsrslrgifssfatgvtvvtvggdsphamtansftsvsldpplilvcvecdaamhgs llevgsfgvsvlaadqqhvallyanrwrprdptqfdrpgwargartgaplargalawfec alwraydagdhsifvgrlltaerhdrrdalvyhsgqfrglpdrap
Timeline for d5choa_: