Lineage for d2ak3a1 (2ak3 A:0-124,A:162-225)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695087Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 695092Protein Adenylate kinase [52554] (14 species)
  7. 695125Species Cow (Bos taurus), mitochondrial izozyme-3 [TaxId:9913] [52557] (1 PDB entry)
    contains a rudiment "zinc-finger" subdomain, residue 125-161
  8. 695126Domain d2ak3a1: 2ak3 A:0-124,A:162-225 [31892]
    Other proteins in same PDB: d2ak3a2, d2ak3b2

Details for d2ak3a1

PDB Entry: 2ak3 (more details), 1.85 Å

PDB Description: the three-dimensional structure of the complex between mitochondrial matrix adenylate kinase and its substrate amp at 1.85 angstroms resolution
PDB Compounds: (A:) adenylate kinase isoenzyme-3

SCOP Domain Sequences for d2ak3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]}
gasarllraaimgapgsgkgtvssritkhfelkhlssgdllrdnmlrgteigvlaktfid
qgklipddvmtrlvlhelknltqynwlldgfprtlpqaealdrayqidtvinlnvpfevi
kqrltXdrpetvvkrlkayeaqtepvleyyrkkgvletfsgtetnkiwphvyaflqtklp
qrsqetsvtp

SCOP Domain Coordinates for d2ak3a1:

Click to download the PDB-style file with coordinates for d2ak3a1.
(The format of our PDB-style files is described here.)

Timeline for d2ak3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ak3a2