Lineage for d5bzpa_ (5bzp A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002036Family d.169.1.4: Link domain [56477] (3 proteins)
  6. 3002054Protein automated matches [190733] (2 species)
    not a true protein
  7. 3002060Species Mouse (Mus musculus) [TaxId:10090] [187906] (31 PDB entries)
  8. 3002068Domain d5bzpa_: 5bzp A: [318914]
    automated match to d4pz4a_
    complexed with 4xg, dms

Details for d5bzpa_

PDB Entry: 5bzp (more details), 1.23 Å

PDB Description: crystal structure of the murine cd44 hyaluronan binding domain complex with a small molecule
PDB Compounds: (A:) CD44 antigen

SCOPe Domain Sequences for d5bzpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bzpa_ d.169.1.4 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nqidlnvtcryagvfhvekngrysisrteaadlcqafnstlptmdqmklalskgfetcry
gfiegnvviprihpnaicaanhtgvyilvtsntshydtycfnasappeedctsvtdlpns
fdgpvtitivnrdgtryskkgeyrthqedi

SCOPe Domain Coordinates for d5bzpa_:

Click to download the PDB-style file with coordinates for d5bzpa_.
(The format of our PDB-style files is described here.)

Timeline for d5bzpa_: