SCOPe 2.08: Domain d5c3mc1: 5c3m C:4-172

Lineage for d5c3mc1 (5c3m C:4-172)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [225639] (6 PDB entries)

8. Domain d5c3mc1: 5c3m C:4-172 [318895]
   Other proteins in same PDB: d5c3ma2, d5c3mb2, d5c3mc2, d5c3md2
   automated match to d1s6ya1
   complexed with mn

Details for d5c3mc1

PDB Entry: 5c3m, 3.06 Å

PDB Description: crystal structure of gan4c, a gh4 6-phospho-glucosidase from geobacillus stearothermophilus

PDB Compounds: (C:) Putative 6-phospho-beta-glucosidase

SCOPe Domain Sequences for d5c3mc1:

Sequence; same for both SEQRES and ATOM records:

>d5c3mc1 c.2.1.0 (C:4-172) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
rlkmatigggssytpelveglikryhelpvgelwlvdipegkekleivgalakrmvekag
vpieihltldrrralegadfvttqfrvgglearakderiplkygvigqetngpgglfkgl
rtipvildiirdmeelcpdawlinftnpagmvteavlrytkqekvvglc

Timeline for d5c3mc1:

• d5c3mc1 first appeared in SCOPe 2.06
  
• d5c3mc1 appears in SCOPe 2.07