SCOPe 2.08: Domain d5c1ja2: 5c1j A:186-335

Lineage for d5c1ja2 (5c1j A:186-335)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Corallococcus coralloides [TaxId:184914] [312199] (3 PDB entries)

8. Domain d5c1ja2: 5c1j A:186-335 [318889]
   automated match to d4yuca2
   complexed with mpd

Details for d5c1ja2

PDB Entry: 5c1j, 1.7 Å

PDB Description: crystal structure of native (reduced) corb

PDB Compounds: (A:) CorB

SCOPe Domain Sequences for d5c1ja2:

Sequence; same for both SEQRES and ATOM records:

>d5c1ja2 c.95.1.0 (A:186-335) automated matches {Corallococcus coralloides [TaxId: 184914]}
ihasqvrtygygaefsmvpgggsrrhpngknttpednylhmngaellkigfeylprfnea
lwkqcpditikdcryviphqpsrvvldylsltypddklvriidrfancigasmpmalyea
vkvgglrrgergvltgtgsgvsfvgmvfty

Timeline for d5c1ja2:

• d5c1ja2 first appeared in SCOPe 2.06
  
• d5c1ja2 appears in SCOPe 2.07