Lineage for d5hf8a_ (5hf8 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2150570Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
    automatically mapped to Pfam PF00135
  6. 2150837Protein automated matches [190065] (6 species)
    not a true protein
  7. 2150843Species Human (Homo sapiens) [TaxId:9606] [186857] (44 PDB entries)
  8. 2150916Domain d5hf8a_: 5hf8 A: [318867]
    automated match to d2xupa_
    complexed with dep, edo, efs, fuc, nag, no3

Details for d5hf8a_

PDB Entry: 5hf8 (more details), 2.8 Å

PDB Description: crystal structure of human acetylcholinesterase in complex with paraoxon (alternative acyl loop conformation)
PDB Compounds: (A:) acetylcholinesterase

SCOPe Domain Sequences for d5hf8a_:

Sequence, based on SEQRES records: (download)

>d5hf8a_ c.69.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvdat
tfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiygggf
ysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalqwv
qenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgmge
arrratqlahlvgcppggtggndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvpvv
dgdflsdtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraeflagv
rvgvpqvsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaqga
rvyayvfehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywanf
artgdpneprdpkapqwppytagaqqyvsldlrplevrrglraqacafwnrflpkllsa

Sequence, based on observed residues (ATOM records): (download)

>d5hf8a_ c.69.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvdat
tfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiygggf
ysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalqwv
qenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgmge
arrratqlahlvgcpndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvpvvdgdfls
dtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraeflagvrvgvpq
vsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaqgarvyayv
fehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywanfartgdp
neprdpkapqwppytagaqqyvsldlrplevrrglraqacafwnrflpkllsa

SCOPe Domain Coordinates for d5hf8a_:

Click to download the PDB-style file with coordinates for d5hf8a_.
(The format of our PDB-style files is described here.)

Timeline for d5hf8a_: