Lineage for d5k13a_ (5k13 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2011946Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2012913Protein automated matches [190059] (14 species)
    not a true protein
  7. 2012935Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2013055Domain d5k13a_: 5k13 A: [318861]
    automated match to d1xdkb_
    complexed with 6q7

Details for d5k13a_

PDB Entry: 5k13 (more details), 1.85 Å

PDB Description: crystal structure of the rar alpha ligand-binding domain in complex with an antagonist
PDB Compounds: (A:) retinoic acid receptor alpha

SCOPe Domain Sequences for d5k13a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k13a_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tpevgeliekvrkahqetfpalcqlgkyttnnsseqrvsldidlwdkfselstkciiktv
efakqlpgfttltiadqitllkaacldililrictrytpeqdtmtfsdgltlnrtqmhna
gfgpltdlvfafanqllplemddaetgllsaiclicgdrqdleqpdrvdmlqepllealk
vyvrkrrpsrphmfpkmlmkitdlrsisakgaervitlkmeipgsmppliqemle

SCOPe Domain Coordinates for d5k13a_:

Click to download the PDB-style file with coordinates for d5k13a_.
(The format of our PDB-style files is described here.)

Timeline for d5k13a_: