SCOPe 2.06: Domain d5jhzb2: 5jhz B:476-784

Lineage for d5jhzb2 (5jhz B:476-784)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.0: automated matches [191605] (1 protein)
   not a true family

6. Protein automated matches [191104] (11 species)
   not a true protein

7. Species Magnaporthe oryzae [TaxId:242507] [226424] (5 PDB entries)

8. Domain d5jhzb2: 5jhz B:476-784 [318853]
   automated match to d3ut2a2
   complexed with hem

Details for d5jhzb2

PDB Entry: 5jhz, 1.7 Å

PDB Description: crystal structure of fungal magkatg2 at ph 7.0

PDB Compounds: (B:) Catalase-peroxidase 2

SCOPe Domain Sequences for d5jhzb2:

Sequence; same for both SEQRES and ATOM records:

>d5jhzb2 a.93.1.0 (B:476-784) automated matches {Magnaporthe oryzae [TaxId: 242507]}
kesfiwqdplparegdliddadvdklkaailstdgldvsklastamacattyrnsdkrgg
cngarialepqrnwvsnnptqlsavldalkkvqsdfngsngnkkvsladlivlggtaave
kaakdagvdikvpfsagrvdatqeqtdvtqfsylepqadgfrnygrgtararteeimvdk
asqltltppeltvlvggmralganydgsdvgvftankgkltpdffvnlvdmniawtasga
dgeswvgtdrksrsekykgsradlvfgshaelraiaevyaengnqekfvkdfvaawtkvm
nldrfdlkv

Timeline for d5jhzb2:

• d5jhzb2 is new in SCOPe 2.06-stable
  
• d5jhzb2 appears in SCOPe 2.07
  
• d5jhzb2 appears in the current release, SCOPe 2.08