Lineage for d3adk__ (3adk -)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581394Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (18 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 581395Protein Adenylate kinase [52554] (14 species)
  7. 581451Species Pig (Sus scrofa) [TaxId:9823] [52555] (1 PDB entry)
  8. 581452Domain d3adk__: 3adk - [31885]
    complexed with so4

Details for d3adk__

PDB Entry: 3adk (more details), 2.1 Å

PDB Description: refined structure of porcine cytosolic adenylate kinase at 2.1 angstroms resolution

SCOP Domain Sequences for d3adk__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3adk__ c.37.1.1 (-) Adenylate kinase {Pig (Sus scrofa)}
meeklkkskiifvvggpgsgkgtqcekivqkygythlstgdllraevssgsargkmlsei
mekgqlvpletvldmlrdamvakvdtskgflidgyprevkqgeeferkigqptlllyvda
gpetmtkrllkrgetsgrvddneetikkrletyykatepviafyekrgivrkvnaegsvd
dvfsqvcthldtlk

SCOP Domain Coordinates for d3adk__:

Click to download the PDB-style file with coordinates for d3adk__.
(The format of our PDB-style files is described here.)

Timeline for d3adk__: