Class a: All alpha proteins [46456] (289 folds) |
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) |
Family a.93.1.0: automated matches [191605] (1 protein) not a true family |
Protein automated matches [191104] (11 species) not a true protein |
Species Magnaporthe oryzae [TaxId:242507] [226424] (5 PDB entries) |
Domain d5jhza1: 5jhz A:50-475 [318841] automated match to d3ut2a1 complexed with hem |
PDB Entry: 5jhz (more details), 1.7 Å
SCOPe Domain Sequences for d5jhza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jhza1 a.93.1.0 (A:50-475) automated matches {Magnaporthe oryzae [TaxId: 242507]} ttfgrcavksnqagggtrshdwwpcqlrldvlrqfqpsqnplggdfdyaeafqsldyeav kkdiaalmtesqdwwpadfgnygglfvrmawhsagtyramdgrggggmgqqrfaplnswp dnqnldkarrliwpikqkygnkiswadlmlltgnvalenmgfktlgfgggradtwqsdea vywgaettfvpqgndvrynnsvdinaradklekplaathmgliyvnpegpngtpdpaasa kdireafgrmgmndtetvaliagghafgkthgavkgsnigpapeaadlgmqglgwhnsvg dgngpnqmtsgleviwtktptkwsngyleslinnnwtlvespagahqweavngtvdypdp fdktkfrkatmltsdlalindpeylkisqrwlehpeeladafakawfkllhrdlgpttry lgpevp
Timeline for d5jhza1: