Lineage for d5l9aa1 (5l9a A:3-321)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2849133Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226760] (22 PDB entries)
  8. 2849150Domain d5l9aa1: 5l9a A:3-321 [318818]
    Other proteins in same PDB: d5l9aa2, d5l9ab2
    automated match to d4yraa_
    complexed with act

Details for d5l9aa1

PDB Entry: 5l9a (more details), 1.45 Å

PDB Description: l-threonine dehydrogenase from trypanosoma brucei.
PDB Compounds: (A:) L-threonine 3-dehydrogenase

SCOPe Domain Sequences for d5l9aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l9aa1 c.2.1.0 (A:3-321) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
prvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsngf
eklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipstiaa
fgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatlpg
ggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvyni
tgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkydid
mmsedmlrqipilhglpsl

SCOPe Domain Coordinates for d5l9aa1:

Click to download the PDB-style file with coordinates for d5l9aa1.
(The format of our PDB-style files is described here.)

Timeline for d5l9aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5l9aa2