Lineage for d5jhxb2 (5jhx B:476-783)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2005118Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2005119Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2005953Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2005954Protein automated matches [191104] (11 species)
    not a true protein
  7. 2005982Species Magnaporthe oryzae [TaxId:242507] [226424] (5 PDB entries)
  8. 2005990Domain d5jhxb2: 5jhx B:476-783 [318804]
    automated match to d3ut2a2
    complexed with flc, hem

Details for d5jhxb2

PDB Entry: 5jhx (more details), 1.4 Å

PDB Description: crystal structure of fungal magkatg2 at ph 3.0
PDB Compounds: (B:) Catalase-peroxidase 2

SCOPe Domain Sequences for d5jhxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jhxb2 a.93.1.0 (B:476-783) automated matches {Magnaporthe oryzae [TaxId: 242507]}
kesfiwqdplparegdliddadvdklkaailstdgldvsklastamacattyrnsdkrgg
cngarialepqrnwvsnnptqlsavldalkkvqsdfngsngnkkvsladlivlggtaave
kaakdagvdikvpfsagrvdatqeqtdvtqfsylepqadgfrnygrgtararteeimvdk
asqltltppeltvlvggmralganydgsdvgvftankgkltpdffvnlvdmniawtasga
dgeswvgtdrksrsekykgsradlvfgshaelraiaevyaengnqekfvkdfvaawtkvm
nldrfdlk

SCOPe Domain Coordinates for d5jhxb2:

Click to download the PDB-style file with coordinates for d5jhxb2.
(The format of our PDB-style files is described here.)

Timeline for d5jhxb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jhxb1