Lineage for d5i46l_ (5i46 L:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2635894Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2635903Protein Coagulation factor VIIa [57201] (1 species)
  7. 2635904Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 2635983Domain d5i46l_: 5i46 L: [318770]
    Other proteins in same PDB: d5i46h_
    automated match to d1cvwl_
    complexed with 67o, ca, mes, so4

Details for d5i46l_

PDB Entry: 5i46 (more details), 2.06 Å

PDB Description: factor viia in complex with the inhibitor (2r,15r)-2-[(1- aminoisoquinolin-6-yl)amino]-8-fluoro-7-hydroxy-4,15,17-trimethyl-13- oxa-4,11-diazatricyclo[14.2.2.1~6,10~]henicosa-1(18),6(21),7,9,16,19- hexaene-3,12-dione
PDB Compounds: (L:) Coagulation factor VII (light chain)

SCOPe Domain Sequences for d5i46l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i46l_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr

SCOPe Domain Coordinates for d5i46l_:

Click to download the PDB-style file with coordinates for d5i46l_.
(The format of our PDB-style files is described here.)

Timeline for d5i46l_: