Lineage for d5hfaa_ (5hfa A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2474357Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
    automatically mapped to Pfam PF00135
  6. 2474358Protein Acetylcholinesterase [53476] (6 species)
  7. 2474370Species Human (Homo sapiens) [TaxId:9606] [53480] (16 PDB entries)
  8. 2474380Domain d5hfaa_: 5hfa A: [318746]
    automated match to d2xupa_
    complexed with dep, edo, fp1, fuc, nag, no3

Details for d5hfaa_

PDB Entry: 5hfa (more details), 2.2 Å

PDB Description: crystal structure of human acetylcholinesterase in complex with paraoxon and 2-pam
PDB Compounds: (A:) acetylcholinesterase

SCOPe Domain Sequences for d5hfaa_:

Sequence, based on SEQRES records: (download)

>d5hfaa_ c.69.1.1 (A:) Acetylcholinesterase {Human (Homo sapiens) [TaxId: 9606]}
edaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvdat
tfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiygggf
ysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalqwv
qenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgmge
arrratqlahlvgcppggtggndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvpvv
dgdflsdtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraeflagv
rvgvpqvsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaqga
rvyayvfehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywanf
artgdpneprdpkapqwppytagaqqyvsldlrplevrrglraqacafwnrflpkllsa

Sequence, based on observed residues (ATOM records): (download)

>d5hfaa_ c.69.1.1 (A:) Acetylcholinesterase {Human (Homo sapiens) [TaxId: 9606]}
edaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvdat
tfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiygggf
ysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalqwv
qenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgmge
arrratqlahlvgcpndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvpvvdgdfls
dtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraeflagvrvgvpq
vsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaqgarvyayv
fehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywanfartgdp
neprdpkapqwppytagaqqyvsldlrplevrrglraqacafwnrflpkllsa

SCOPe Domain Coordinates for d5hfaa_:

Click to download the PDB-style file with coordinates for d5hfaa_.
(The format of our PDB-style files is described here.)

Timeline for d5hfaa_: