SCOPe 2.06: Domain d5ci2a_: 5ci2 A:

Lineage for d5ci2a_ (5ci2 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein automated matches [190435] (11 species)
   not a true protein

7. Species Escherichia coli [TaxId:83334] [318744] (2 PDB entries)

8. Domain d5ci2a_: 5ci2 A: [318745]
   automated match to d1jqcb_
   complexed with feo, so4

Details for d5ci2a_

PDB Entry: 5ci2, 2.25 Å

PDB Description: ribonucleotide reductase y122 2,3,6-f3y variant

PDB Compounds: (A:) ribonucleoside-diphosphate reductase 1 subunit beta

SCOPe Domain Sequences for d5ci2a_:

Sequence; same for both SEQRES and ATOM records:

>d5ci2a_ a.25.1.2 (A:) automated matches {Escherichia coli [TaxId: 83334]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sxthiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlvsdnvqvapq

Timeline for d5ci2a_:

• d5ci2a_ is new in SCOPe 2.06-stable
  
• d5ci2a_ appears in SCOPe 2.07
  
• d5ci2a_ appears in the current release, SCOPe 2.08