Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
Protein Ribonucleotide reductase R2 [47257] (10 species) |
Species Escherichia coli [TaxId:745156] [318807] (3 PDB entries) |
Domain d5ci1a_: 5ci1 A: [318728] automated match to d1jqcb_ complexed with cl, feo, so4 |
PDB Entry: 5ci1 (more details), 1.95 Å
SCOPe Domain Sequences for d5ci1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ci1a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 745156]} ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr sxthiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlvsdnvqvapq
Timeline for d5ci1a_: