Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Fibroblast growth factor receptor 1 [56158] (1 species) PTK group; FGFR subfamily; membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56159] (47 PDB entries) |
Domain d5b7va_: 5b7v A: [318720] automated match to d1fgka_ complexed with lwj, so4 |
PDB Entry: 5b7v (more details), 2.15 Å
SCOPe Domain Sequences for d5b7va_:
Sequence, based on SEQRES records: (download)
>d5b7va_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgley synpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfg lardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypg vpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsn
>d5b7va_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} elpedprwelprdrlvlgkplgeqvvlaeaigldkdkpnrvtkvavkmlksdatekdlsd lisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpppeeqlssk dlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglarhidyykkttngr lpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdk psnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsn
Timeline for d5b7va_: