Lineage for d5c6eb_ (5c6e B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1977443Protein Hemoglobin, beta-chain [46500] (25 species)
  7. 1977542Species Horse (Equus caballus) [TaxId:9796] [46504] (17 PDB entries)
  8. 1977552Domain d5c6eb_: 5c6e B: [318704]
    Other proteins in same PDB: d5c6ea_
    automated match to d1ns9b_
    complexed with cyn, dod, hem

Details for d5c6eb_

PDB Entry: 5c6e (more details), 1.7 Å

PDB Description: joint x-ray/neutron structure of equine cyanomet hemoglobin in r state
PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d5c6eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c6eb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh

SCOPe Domain Coordinates for d5c6eb_:

Click to download the PDB-style file with coordinates for d5c6eb_.
(The format of our PDB-style files is described here.)

Timeline for d5c6eb_: