Lineage for d5c5bc2 (5c5b C:274-375)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2071584Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2071585Protein automated matches [190052] (6 species)
    not a true protein
  7. 2071626Species Human (Homo sapiens) [TaxId:9606] [186914] (54 PDB entries)
  8. 2071693Domain d5c5bc2: 5c5b C:274-375 [318702]
    Other proteins in same PDB: d5c5ba1, d5c5ba3, d5c5bb1, d5c5bc1, d5c5bc3, d5c5bd1
    automated match to d2q13a2
    complexed with gol

Details for d5c5bc2

PDB Entry: 5c5b (more details), 2.9 Å

PDB Description: crystal structure of human appl bar-ph heterodimer
PDB Compounds: (C:) DCC-interacting protein 13-alpha

SCOPe Domain Sequences for d5c5bc2:

Sequence, based on SEQRES records: (download)

>d5c5bc2 b.55.1.0 (C:274-375) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrnltrkagylnarnktglvsstwdrqfyftqggnlmsqargdvagglamdidncsvmav
dcedrrycfqitsfdgkkssilqaeskkdheewictinnisk

Sequence, based on observed residues (ATOM records): (download)

>d5c5bc2 b.55.1.0 (C:274-375) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrnltrkagylnarnstwdrqfyftqggnlmsqargdvagglamdidncsvmavdcedrr
ycfqitsfdgkkssilqaeskkdheewictinnisk

SCOPe Domain Coordinates for d5c5bc2:

Click to download the PDB-style file with coordinates for d5c5bc2.
(The format of our PDB-style files is described here.)

Timeline for d5c5bc2: