SCOPe 2.06: Domain d5c6ea_: 5c6e A:

Lineage for d5c6ea_ (5c6e A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (24 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46488] (17 PDB entries)

8. Domain d5c6ea_: 5c6e A: [318693]
   Other proteins in same PDB: d5c6eb_
   automated match to d1iwha_
   complexed with cyn, dod, hem

Details for d5c6ea_

PDB Entry: 5c6e, 1.7 Å

PDB Description: joint x-ray/neutron structure of equine cyanomet hemoglobin in r state

PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d5c6ea_:

Sequence; same for both SEQRES and ATOM records:

>d5c6ea_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsnlsdlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

Timeline for d5c6ea_:

• d5c6ea_ is new in SCOPe 2.06-stable
  
• d5c6ea_ appears in SCOPe 2.07
  
• d5c6ea_ appears in the current release, SCOPe 2.08