SCOPe 2.08: Domain d5c2jb_: 5c2j B:

Lineage for d5c2jb_ (5c2j B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [159559] (2 PDB entries)

8. Domain d5c2jb_: 5c2j B: [318684]
   Other proteins in same PDB: d5c2ja_
   automated match to d1ajea_
   complexed with af3, gdp, mg

Details for d5c2jb_

PDB Entry: 5c2j, 2.5 Å

PDB Description: complex structure of the gap domain of mgcracgap and cdc42

PDB Compounds: (B:) Cell division control protein 42 homolog

SCOPe Domain Sequences for d5c2jb_:

Sequence; same for both SEQRES and ATOM records:

>d5c2jb_ c.37.1.8 (B:) CDC42 {Mouse (Mus musculus) [TaxId: 10090]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
epkksrrcvll

Timeline for d5c2jb_:

• d5c2jb_ first appeared in SCOPe 2.06
  
• d5c2jb_ appears in SCOPe 2.07