Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein CDC42 [52619] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [159559] (2 PDB entries) |
Domain d5c2jb_: 5c2j B: [318684] Other proteins in same PDB: d5c2ja_ automated match to d1ajea_ complexed with af3, gdp, mg |
PDB Entry: 5c2j (more details), 2.5 Å
SCOPe Domain Sequences for d5c2jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c2jb_ c.37.1.8 (B:) CDC42 {Mouse (Mus musculus) [TaxId: 10090]} mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp epkksrrcvll
Timeline for d5c2jb_: