SCOPe 2.08: Domain d5b2ha2: 5b2h A:149-285

Lineage for d5b2ha2 (5b2h A:149-285)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein automated matches [190608] (4 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:1491] [230685] (7 PDB entries)

8. Domain d5b2ha2: 5b2h A:149-285 [318580]
   automated match to d2e4ma2
   complexed with pge

Details for d5b2ha2

PDB Entry: 5b2h, 2.2 Å

PDB Description: crystal structure of ha33 from clostridium botulinum serotype c strain yoichi

PDB Compounds: (A:) ha-33

SCOPe Domain Sequences for d5b2ha2:

Sequence; same for both SEQRES and ATOM records:

>d5b2ha2 b.42.2.1 (A:149-285) automated matches {Clostridium botulinum [TaxId: 1491]}
nstckiqtsltikfidknqnsnnvtiwswnngdnqkwkilyneskmaytltciknneylt
wfssignnvgtyrtegnndqywfinylnndasmytisnfsnqskfldvvnsgladgtnvq
vwdsngtsaqkwiitrl

Timeline for d5b2ha2:

• d5b2ha2 first appeared in SCOPe 2.06
  
• d5b2ha2 appears in SCOPe 2.07