Lineage for d5jmcc1 (5jmc C:872-1092)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051091Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins)
    automatically mapped to Pfam PF07953
  6. 2051134Protein automated matches [229097] (4 species)
    not a true protein
  7. 2051135Species Clostridium botulinum [TaxId:1491] [229098] (8 PDB entries)
  8. 2051147Domain d5jmcc1: 5jmc C:872-1092 [318568]
    Other proteins in same PDB: d5jmca2, d5jmca3, d5jmca4, d5jmcc2, d5jmcc3, d5jmcc4, d5jmce2, d5jmce3, d5jmce4, d5jmcg2, d5jmcg3, d5jmcg4
    automated match to d3btaa1

Details for d5jmcc1

PDB Entry: 5jmc (more details), 2.64 Å

PDB Description: receptor binding domain of botulinum neurotoxin a in complex with rat sv2c
PDB Compounds: (C:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d5jmcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jmcc1 b.29.1.6 (C:872-1092) automated matches {Clostridium botulinum [TaxId: 1491]}
niintsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilkna
ivynsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtq
eikqrvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasn
nimfkldgcrdthryiwikyfnlfdkelnekeikdlydnqs

SCOPe Domain Coordinates for d5jmcc1:

Click to download the PDB-style file with coordinates for d5jmcc1.
(The format of our PDB-style files is described here.)

Timeline for d5jmcc1: