Lineage for d5jmce2 (5jmc E:1093-1296)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2062236Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2062297Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins)
    overall fold is very similar to that of the STI family
    automatically mapped to Pfam PF07951
  6. 2062340Protein automated matches [229100] (4 species)
    not a true protein
  7. 2062341Species Clostridium botulinum [TaxId:1491] [229101] (9 PDB entries)
  8. 2062356Domain d5jmce2: 5jmc E:1093-1296 [318548]
    Other proteins in same PDB: d5jmca1, d5jmca3, d5jmca4, d5jmcc1, d5jmcc3, d5jmcc4, d5jmce1, d5jmce3, d5jmce4, d5jmcg1, d5jmcg3, d5jmcg4
    automated match to d3btaa2

Details for d5jmce2

PDB Entry: 5jmc (more details), 2.64 Å

PDB Description: receptor binding domain of botulinum neurotoxin a in complex with rat sv2c
PDB Compounds: (E:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d5jmce2:

Sequence, based on SEQRES records: (download)

>d5jmce2 b.42.4.2 (E:1093-1296) automated matches {Clostridium botulinum [TaxId: 1491]}
nsgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgprgsvmttniylns
slyrgakfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasqagvekilsaleip
dvgnlsqvvvmkskndqgitnkckmnlqdnngndigfigfhqfnniaklvasnwynrqie
rssrtlgcswefipvddgwgerpl

Sequence, based on observed residues (ATOM records): (download)

>d5jmce2 b.42.4.2 (E:1093-1296) automated matches {Clostridium botulinum [TaxId: 1491]}
nsgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgprgsvmttniylns
slyrgakfiikkynkdnivrnndrvyinvvvknkeyrlatnasqagvekilsaleipdvg
nlsqvvvmkskndtnkckmnlqdnngndigfigfhqfnniaklvasnwynrqrtlgcswe
fipvddgwgerpl

SCOPe Domain Coordinates for d5jmce2:

Click to download the PDB-style file with coordinates for d5jmce2.
(The format of our PDB-style files is described here.)

Timeline for d5jmce2: