Lineage for d5jlvb1 (5jlv B:872-1092)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051091Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins)
    automatically mapped to Pfam PF07953
  6. 2051134Protein automated matches [229097] (4 species)
    not a true protein
  7. 2051135Species Clostridium botulinum [TaxId:1491] [229098] (8 PDB entries)
  8. 2051139Domain d5jlvb1: 5jlv B:872-1092 [318532]
    Other proteins in same PDB: d5jlva2, d5jlva3, d5jlvb2, d5jlvb3
    automated match to d3btaa1
    complexed with act, bma, fuc, nag, po4

Details for d5jlvb1

PDB Entry: 5jlv (more details), 2 Å

PDB Description: receptor binding domain of botulinum neurotoxin a in complex with human glycosylated sv2c
PDB Compounds: (B:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d5jlvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jlvb1 b.29.1.6 (B:872-1092) automated matches {Clostridium botulinum [TaxId: 1491]}
niintsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilkna
ivynsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtq
eikqrvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasn
nimfkldgcrdthryiwikyfnlfdkelnekeikdlydnqs

SCOPe Domain Coordinates for d5jlvb1:

Click to download the PDB-style file with coordinates for d5jlvb1.
(The format of our PDB-style files is described here.)

Timeline for d5jlvb1: