Lineage for d5c70b3 (5c70 B:276-592)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095570Species Fungus (Aspergillus oryzae) [TaxId:5062] [256307] (3 PDB entries)
  8. 2095577Domain d5c70b3: 5c70 B:276-592 [318529]
    Other proteins in same PDB: d5c70a1, d5c70a2, d5c70b1, d5c70b2
    automated match to d5czkb3

Details for d5c70b3

PDB Entry: 5c70 (more details), 3.1 Å

PDB Description: the structure of aspergillus oryzae beta-glucuronidase
PDB Compounds: (B:) Glucuronidase

SCOPe Domain Sequences for d5c70b3:

Sequence, based on SEQRES records: (download)

>d5c70b3 c.1.8.0 (B:276-592) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]}
vkvqgtqflindkpfyftgfgkhedtnirgkghddaymvhdfqllhwmgansfrtshypy
aeevmeyadrqgivvidetpavglafsigagaqtsnppatfspdrinnktreahaqaire
lihrdknhpsvvmwsianepasnedgareyfaplpklarqldptrpvtfanvglatykad
riadlfdvlclnryfgwytqtaeldeaeaaleeelrgwtekydkpivmteygadtvaglh
svmvtpwseefqvemldmyhrvfdrfeamageqvwnfadfqtavgvsrvdgnkkgvftrd
rkpkaaahllrkrwtnl

Sequence, based on observed residues (ATOM records): (download)

>d5c70b3 c.1.8.0 (B:276-592) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]}
vkvqgtqflindkpfyftgfgkhedtnirgkghddaymvhdfqllhwmgansfrtshypy
aeevmeyadrqgivvidetpavglafspatfspdrinnktreahaqairelihrdknhps
vvmwsianepasnedgareyfaplpklarqldptrpvtfanvglatykadriadlfdvlc
lnryfgwytqtaeldeaeaaleeelrgwtekydkpivmteygadtvaglhsvmvtpwsee
fqvemldmyhrvfdrfeamageqvwnfadfqtavgvsrvdgnkkgvftrdrkpkaaahll
rkrwtnl

SCOPe Domain Coordinates for d5c70b3:

Click to download the PDB-style file with coordinates for d5c70b3.
(The format of our PDB-style files is described here.)

Timeline for d5c70b3: