Lineage for d5c70b1 (5c70 B:-1-180)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046279Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2046280Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2047120Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2047121Protein automated matches [190770] (37 species)
    not a true protein
  7. 2047309Species Fungus (Aspergillus oryzae) [TaxId:5062] [256310] (3 PDB entries)
  8. 2047317Domain d5c70b1: 5c70 B:-1-180 [318526]
    Other proteins in same PDB: d5c70a2, d5c70a3, d5c70b2, d5c70b3
    automated match to d5czkb1

Details for d5c70b1

PDB Entry: 5c70 (more details), 3.1 Å

PDB Description: the structure of aspergillus oryzae beta-glucuronidase
PDB Compounds: (B:) Glucuronidase

SCOPe Domain Sequences for d5c70b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c70b1 b.18.1.0 (B:-1-180) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]}
gsmlkpqqtttrdlisldglwkfalasddnntqpwtsqlktslecpvpasyndifadski
hdhvgwvyyqrdvivpkgwseerylvrceaathhgriyvngnlvadhvggytpfeaditd
lvaageqfrltiavdneltyqtippgkveileatgkkvqtyqhdfynyaglarsvwlysv
pq

SCOPe Domain Coordinates for d5c70b1:

Click to download the PDB-style file with coordinates for d5c70b1.
(The format of our PDB-style files is described here.)

Timeline for d5c70b1: