SCOPe 2.08: Domain d5jejb_: 5jej B:

Lineage for d5jejb_ (5jej B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families)
   has a few short helices inserted in loops

5. Family b.26.1.3: Interferon regulatory factor 3 (IRF3), transactivation domain [101630] (1 protein)
   weak sequence similarity to SMAD domain

6. Protein Interferon regulatory factor 3 (IRF3), transactivation domain [101631] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101632] (8 PDB entries)

8. Domain d5jejb_: 5jej B: [318523]
   automated match to d3a77a_

Details for d5jejb_

PDB Entry: 5jej, 2 Å

PDB Description: phosphorylated sting in complex with irf-3 ctd

PDB Compounds: (B:) Interferon regulatory factor 3

SCOPe Domain Sequences for d5jejb_:

Sequence; same for both SEQRES and ATOM records:

>d5jejb_ b.26.1.3 (B:) Interferon regulatory factor 3 (IRF3), transactivation domain {Human (Homo sapiens) [TaxId: 9606]}
enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtlpdp
gmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpd
gevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvv
ptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdf

Timeline for d5jejb_:

• d5jejb_ first appeared in SCOPe 2.06
  
• d5jejb_ appears in SCOPe 2.07