SCOPe 2.08: Domain d5j1ea2: 5j1e A:430-553

Lineage for d5j1ea2 (5j1e A:430-553)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId:11678] [275362] (22 PDB entries)

8. Domain d5j1ea2: 5j1e A:430-553 [318519]
   Other proteins in same PDB: d5j1ea1, d5j1eb1, d5j1eb2, d5j1ec1, d5j1ed_
   automated match to d1dloa1
   complexed with 6ft, mg

Details for d5j1ea2

PDB Entry: 5j1e, 2.9 Å

PDB Description: crystal structure of a hydroxypyridone carboxylic acid active-site rnase h inhibitor in complex with hiv reverse transcriptase

PDB Compounds: (A:) hiv-1 reverse transcriptase p66 domain

SCOPe Domain Sequences for d5j1ea2:

Sequence; same for both SEQRES and ATOM records:

>d5j1ea2 c.55.3.0 (A:430-553) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvs

Timeline for d5j1ea2:

• d5j1ea2 first appeared in SCOPe 2.06
  
• d5j1ea2 appears in SCOPe 2.07