Lineage for d3ukd__ (3ukd -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (8 proteins) 
Protein UMP/CMP kinase [52550] (1 species) Species Dictyostelium discoideum [TaxId:44689] [52551] (6 PDB entries) 
Domain d3ukd__: 3ukd - [31849]
Details for d3ukd__
PDB Entry: 3ukd (more details), 1.9 Å
PDB Description: ump/cmp kinase from slime mold complexed with adp, cmp, and alf3
SCOP Domain Sequences for d3ukd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ukd__ c.37.1.1 (-) UMP/CMP kinase {Dictyostelium discoideum}
skpnvvfvlggpgsgkgtqcanivrdfgwvhlsagdllrqeqqsgskdgemiatmiknge
ivpsivtvkllknaidanqgknflvdgfprneennnsweenmkdfvdtkfvlffdcpeev
mtqrllkrgessgrsddniesikkrfntfnvqtklvidhynkfdkvkiipanrdvnevyn
dvenlfksmgf
SCOP Domain Coordinates for d3ukd__:
Click to download the PDB-style file with coordinates for d3ukd__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ukd__:
- d3ukd__ appears in SCOP 1.57
- d3ukd__ appears in the current release, SCOPe 2.08, called d3ukda_
View in 3D