Lineage for d5f21b_ (5f21 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034460Species Llama (Lama glama) [TaxId:9844] [189241] (9 PDB entries)
  8. 2034463Domain d5f21b_: 5f21 B: [318474]
    Other proteins in same PDB: d5f21a_
    automated match to d4nbzb_
    complexed with gol, so4

Details for d5f21b_

PDB Entry: 5f21 (more details), 1.9 Å

PDB Description: human cd38 in complex with nanobody mu375
PDB Compounds: (B:) nanobody MU375

SCOPe Domain Sequences for d5f21b_:

Sequence, based on SEQRES records: (download)

>d5f21b_ b.1.1.0 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlqesgggsvqaggsltlsctasgllfrlasmgwyrqapgkereliatitvggktnykds
vqgrfiitrdntgdntkstvtlqmnrlkpedtavyycntaspavgadtwgqgtrvtvs

Sequence, based on observed residues (ATOM records): (download)

>d5f21b_ b.1.1.0 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlqesgggsvqaggsltlsctasgllfrlasmgwyrqapgkereliatitvggktnykds
vqgrfiitrdntkstvtlqmnrlkpedtavyycntaspavgadtwgqgtrvtvs

SCOPe Domain Coordinates for d5f21b_:

Click to download the PDB-style file with coordinates for d5f21b_.
(The format of our PDB-style files is described here.)

Timeline for d5f21b_: