SCOPe 2.08: Domain d5f21b_: 5f21 B:

Lineage for d5f21b_ (5f21 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)

8. Domain d5f21b_: 5f21 B: [318474]
   Other proteins in same PDB: d5f21a_
   automated match to d4nbzb_
   complexed with gol, so4

Details for d5f21b_

PDB Entry: 5f21, 1.9 Å

PDB Description: human cd38 in complex with nanobody mu375

PDB Compounds: (B:) nanobody MU375

SCOPe Domain Sequences for d5f21b_:

Sequence, based on SEQRES records:

>d5f21b_ b.1.1.0 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlqesgggsvqaggsltlsctasgllfrlasmgwyrqapgkereliatitvggktnykds
vqgrfiitrdntgdntkstvtlqmnrlkpedtavyycntaspavgadtwgqgtrvtvs

Sequence, based on observed residues (ATOM records):

>d5f21b_ b.1.1.0 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlqesgggsvqaggsltlsctasgllfrlasmgwyrqapgkereliatitvggktnykds
vqgrfiitrdntkstvtlqmnrlkpedtavyycntaspavgadtwgqgtrvtvs

Timeline for d5f21b_:

• d5f21b_ first appeared in SCOPe 2.06
  
• d5f21b_ appears in SCOPe 2.07