Lineage for d5bxlc_ (5bxl C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2230570Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2230571Protein automated matches [190509] (14 species)
    not a true protein
  7. 2230621Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2230890Domain d5bxlc_: 5bxl C: [318472]
    Other proteins in same PDB: d5bxla_, d5bxlb_, d5bxlf_, d5bxlg_, d5bxlh_, d5bxli_, d5bxlj_, d5bxlk_, d5bxll_, d5bxlm_, d5bxln_, d5bxlo_, d5bxlp_, d5bxlt_, d5bxlu_, d5bxlv_, d5bxlw_, d5bxlx_, d5bxly_, d5bxlz_
    automated match to d1iruf_
    complexed with cl, mg; mutant

Details for d5bxlc_

PDB Entry: 5bxl (more details), 2.8 Å

PDB Description: yeast 20s proteasome beta2-g170a mutant
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5bxlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bxlc_ d.153.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d5bxlc_:

Click to download the PDB-style file with coordinates for d5bxlc_.
(The format of our PDB-style files is described here.)

Timeline for d5bxlc_: