SCOPe 2.08: Domain d5cfca_: 5cfc A:

Lineage for d5cfca_ (5cfc A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein automated matches [190854] (27 species)
   not a true protein

7. Species Saffold virus [TaxId:434309] [318368] (2 PDB entries)

8. Domain d5cfca_: 5cfc A: [318440]
   automated match to d1tme1_

Details for d5cfca_

PDB Entry: 5cfc, 2.5 Å

PDB Description: crystal structure of human cardiovirus safv-3

PDB Compounds: (A:) vp1

SCOPe Domain Sequences for d5cfca_:

Sequence; same for both SEQRES and ATOM records:

>d5cfca_ b.121.4.1 (A:) automated matches {Saffold virus [TaxId: 434309]}
gvdnaekgkvsddnastdfvaepvklpenqtrvsffydrstlssvlqstsdvsskftpst
aknlqnsilltplpsdivnnsvlpeqerwisfaspttqkppyktkqdwnfimfspftyyk
cdlevtlskndretissvvryvpcgapsdlsdqtmpqtpsladtrdphmwvvgqgttnqi
sfvipytsplsvlpsvwfngfsnfdnssrfgvapnadfgrlllqgqgtfsvhyrykkmrv
fcprptvfipwp

Timeline for d5cfca_:

• d5cfca_ first appeared in SCOPe 2.06
  
• d5cfca_ appears in SCOPe 2.07