Lineage for d5bxnb_ (5bxn B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994740Domain d5bxnb_: 5bxn B: [318395]
    Other proteins in same PDB: d5bxna_, d5bxnc1, d5bxnc2, d5bxnd_, d5bxne_, d5bxng_, d5bxni_, d5bxnj_, d5bxnk_, d5bxnl_, d5bxnn_, d5bxno_, d5bxnq1, d5bxnq2, d5bxnr_, d5bxns_, d5bxnu_, d5bxnw_, d5bxnx_, d5bxny_, d5bxnz_
    automated match to d1z7qc1
    complexed with bo2, cl, mg; mutant

Details for d5bxnb_

PDB Entry: 5bxn (more details), 2.8 Å

PDB Description: yeast 20s proteasome beta2-g170a mutant in complex with bortezomib
PDB Compounds: (B:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d5bxnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bxnb_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d5bxnb_:

Click to download the PDB-style file with coordinates for d5bxnb_.
(The format of our PDB-style files is described here.)

Timeline for d5bxnb_: