Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d5bxnb_: 5bxn B: [318395] Other proteins in same PDB: d5bxna_, d5bxnc1, d5bxnc2, d5bxnd_, d5bxne_, d5bxng_, d5bxni_, d5bxnj_, d5bxnk_, d5bxnl_, d5bxnn_, d5bxno_, d5bxnq1, d5bxnq2, d5bxnr_, d5bxns_, d5bxnu_, d5bxnw_, d5bxnx_, d5bxny_, d5bxnz_ automated match to d1z7qc1 complexed with bo2, cl, mg; mutant |
PDB Entry: 5bxn (more details), 2.8 Å
SCOPe Domain Sequences for d5bxnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bxnb_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d5bxnb_:
View in 3D Domains from other chains: (mouse over for more information) d5bxna_, d5bxnc1, d5bxnc2, d5bxnd_, d5bxne_, d5bxnf_, d5bxng_, d5bxnh_, d5bxni_, d5bxnj_, d5bxnk_, d5bxnl_, d5bxnm_, d5bxnn_, d5bxno_, d5bxnp_, d5bxnq1, d5bxnq2, d5bxnr_, d5bxns_, d5bxnt_, d5bxnu_, d5bxnv_, d5bxnw_, d5bxnx_, d5bxny_, d5bxnz_ |