![]() | Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) ![]() |
![]() | Family c.36.1.4: Pyruvate-ferredoxin oxidoreductase, PFOR, domains I and VI [52536] (1 protein) |
![]() | Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domains I and VI [52537] (1 species) |
![]() | Species Desulfovibrio africanus [TaxId:873] [52538] (3 PDB entries) |
![]() | Domain d2pdab1: 2pda B:2-258 [31837] Other proteins in same PDB: d2pdaa3, d2pdaa4, d2pdaa5, d2pdab3, d2pdab4, d2pdab5 |
PDB Entry: 2pda (more details), 3 Å
SCOP Domain Sequences for d2pdab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pdab1 c.36.1.4 (B:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domains I and VI {Desulfovibrio africanus} gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg ivaeymqkvasltgrsy
Timeline for d2pdab1: