Lineage for d2pdaa2 (2pda A:786-1232)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121562Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 121563Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 121652Family c.36.1.4: Pyruvate-ferredoxin oxidoreductase, PFOR, domains I and VI [52536] (1 protein)
  6. 121653Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domains I and VI [52537] (1 species)
  7. 121654Species Desulfovibrio africanus [TaxId:873] [52538] (3 PDB entries)
  8. 121664Domain d2pdaa2: 2pda A:786-1232 [31836]
    Other proteins in same PDB: d2pdaa3, d2pdaa4, d2pdaa5, d2pdab3, d2pdab4, d2pdab5

Details for d2pdaa2

PDB Entry: 2pda (more details), 3 Å

PDB Description: crystal structure of the complex between pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus and pyruvate.

SCOP Domain Sequences for d2pdaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pdaa2 c.36.1.4 (A:786-1232) Pyruvate-ferredoxin oxidoreductase, PFOR, domains I and VI {Desulfovibrio africanus}
vksevlprdslkgsqfqeplmefsgacsgcgetpyvrvitqlfgermfianatgcssiwg
asapsmpyktnrlgqgpawgnslfedaaeygfgmnmsmfarrthladlaakalesdasgd
vkealqgwlagkndpikskeygdklkkllagqkdgllgqiaamsdlytkksvwifggdgw
aydigyggldhvlasgedvnvfvmdtevysntggqsskatptgavakfaaagkrtgkkdl
armvmtygyvyvatvsmgyskqqflkvlkeaesfpgpslviayatcinqglrkgmgksqd
vmntavksgywplfrydprlaaqgknpfqldskapdgsveeflmaqnrfavldrsfpeda
krlraqvaheldvrfkelehmaatnifesfapaggkadgsvdfgegaefctrddtpmmar
pdsgeacdqnragtseqqgdlskrtkk

SCOP Domain Coordinates for d2pdaa2:

Click to download the PDB-style file with coordinates for d2pdaa2.
(The format of our PDB-style files is described here.)

Timeline for d2pdaa2: