Lineage for d2pdaa1 (2pda A:2-258)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69360Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 69361Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 69437Family c.36.1.4: Pyruvate-ferredoxin oxidoreductase, PFOR, domains I and VI [52536] (1 protein)
  6. 69438Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domains I and VI [52537] (1 species)
  7. 69439Species Desulfovibrio africanus [TaxId:873] [52538] (2 PDB entries)
  8. 69444Domain d2pdaa1: 2pda A:2-258 [31835]
    Other proteins in same PDB: d2pdaa3, d2pdaa4, d2pdaa5, d2pdab3, d2pdab4, d2pdab5

Details for d2pdaa1

PDB Entry: 2pda (more details), 3 Å

PDB Description: crystal structure of the complex between pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus and pyruvate.

SCOP Domain Sequences for d2pdaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pdaa1 c.36.1.4 (A:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domains I and VI {Desulfovibrio africanus}
gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem
qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal
sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq
kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg
ivaeymqkvasltgrsy

SCOP Domain Coordinates for d2pdaa1:

Click to download the PDB-style file with coordinates for d2pdaa1.
(The format of our PDB-style files is described here.)

Timeline for d2pdaa1: