SCOPe 2.08: Domain d5jvda2: 5jvd A:246-439

Lineage for d5jvda2 (5jvd A:246-439)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)

Domain d5jvda2: 5jvd A:246-439 [318344]
Other proteins in same PDB: d5jvda1, d5jvdb1, d5jvdc1, d5jvdd1, d5jvde_, d5jvdf1, d5jvdf2, d5jvdf3
automated match to d4i50a2
complexed with 6nl, acp, ca, gdp, gol, gtp, mes, mg

Details for d5jvda2

PDB Entry: 5jvd (more details), 2.39 Å

PDB Description: tubulin-tub092 complex

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5jvda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jvda2 d.79.2.1 (A:246-439) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds

SCOPe Domain Coordinates for d5jvda2:

Click to download the PDB-style file with coordinates for d5jvda2.
(The format of our PDB-style files is described here.)

Timeline for d5jvda2: