Lineage for d1b0pb1 (1b0p B:2-258)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22854Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 22855Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 22931Family c.36.1.4: Pyruvate-ferredoxin oxidoreductase, PFOR, domains I and VI [52536] (1 protein)
  6. 22932Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domains I and VI [52537] (1 species)
  7. 22933Species Desulfovibrio africanus [TaxId:873] [52538] (2 PDB entries)
  8. 22936Domain d1b0pb1: 1b0p B:2-258 [31833]
    Other proteins in same PDB: d1b0pa3, d1b0pa4, d1b0pa5, d1b0pb3, d1b0pb4, d1b0pb5

Details for d1b0pb1

PDB Entry: 1b0p (more details), 2.31 Å

PDB Description: crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus

SCOP Domain Sequences for d1b0pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0pb1 c.36.1.4 (B:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domains I and VI {Desulfovibrio africanus}
gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem
qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal
sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq
kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg
ivaeymqkvasltgrsy

SCOP Domain Coordinates for d1b0pb1:

Click to download the PDB-style file with coordinates for d1b0pb1.
(The format of our PDB-style files is described here.)

Timeline for d1b0pb1: