Lineage for d1b0pa1 (1b0p A:2-258)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242757Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 242758Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
    both pyridine (Pyr)- and pyrophosphate (PP)-binding modules have this fold
    conserved core consists of two Pyr and two PP-modules and binds two coenzyme molecules
  5. 242896Family c.36.1.4: Pyruvate-ferredoxin oxidoreductase, PFOR, domains I and VI [52536] (1 protein)
    domains VI, I and II are arranged in the same way as the TK PP, Pyr and C domains
  6. 242897Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domains I and VI [52537] (1 species)
    domain I is the Pyr module; domain VI is the PP module
  7. 242898Species Desulfovibrio africanus [TaxId:873] [52538] (3 PDB entries)
  8. 242903Domain d1b0pa1: 1b0p A:2-258 [31831]
    Other proteins in same PDB: d1b0pa3, d1b0pa4, d1b0pa5, d1b0pb3, d1b0pb4, d1b0pb5

Details for d1b0pa1

PDB Entry: 1b0p (more details), 2.31 Å

PDB Description: crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus

SCOP Domain Sequences for d1b0pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0pa1 c.36.1.4 (A:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domains I and VI {Desulfovibrio africanus}
gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem
qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal
sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq
kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg
ivaeymqkvasltgrsy

SCOP Domain Coordinates for d1b0pa1:

Click to download the PDB-style file with coordinates for d1b0pa1.
(The format of our PDB-style files is described here.)

Timeline for d1b0pa1: