Lineage for d1qs0a_ (1qs0 A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242757Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 242758Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
    both pyridine (Pyr)- and pyrophosphate (PP)-binding modules have this fold
    conserved core consists of two Pyr and two PP-modules and binds two coenzyme molecules
  5. 242884Family c.36.1.3: Branched-chain alpha-keto acid dehydrogenase THDP-binding domains [52531] (3 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 242885Protein 2-oxoisovalerate dehydrogenase (E1B), PP and Pyr modules [52534] (1 species)
    chain A is alpha-subunit and chain B is beta-subunit
  7. 242886Species Pseudomonas putida [TaxId:303] [52535] (1 PDB entry)
  8. 242887Domain d1qs0a_: 1qs0 A: [31829]
    Other proteins in same PDB: d1qs0b2
    complexed with hri, mg, tdp

Details for d1qs0a_

PDB Entry: 1qs0 (more details), 2.4 Å

PDB Description: Crystal Structure of Pseudomonas Putida 2-oxoisovalerate Dehydrogenase (Branched-Chain Alpha-Keto Acid Dehydrogenase, E1B)

SCOP Domain Sequences for d1qs0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qs0a_ c.36.1.3 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP and Pyr modules {Pseudomonas putida}
neyaplrlhvpeptgrpgcqtdfsylrlndagqarkppvdvdaadtadlsyslvrvldeq
gdaqgpwaedidpqilrqgmramlktrifdsrmvvaqrqkkmsfymqslgeeaigsgqal
alnrtdmcfptyrqqsilmardvslvemicqllsnerdplkgrqlpimysvreagfftis
gnlatqfvqavgwamasaikgdtkiasawigdgataesdfhtaltfahvyrapvilnvvn
nqwaistfqaiaggesttfagrgvgcgiaslrvdgndfvavyaasrwaaerarrglgpsl
iewvtyragphstsddpskyrpaddwshfplgdpiarlkqhlikighwseeehqattaef
eaaviaaqkeaeqygtlanghipsaasmfedvykempdhlrrqrqel

SCOP Domain Coordinates for d1qs0a_:

Click to download the PDB-style file with coordinates for d1qs0a_.
(The format of our PDB-style files is described here.)

Timeline for d1qs0a_: