Lineage for d1qs0a1 (1qs0 A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179051Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 179052Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 179135Family c.36.1.3: Branched-chain alpha-keto acid dehydrogenase [52531] (3 proteins)
  6. 179136Protein 2-oxoisovalerate dehydrogenase, E1B [52534] (1 species)
  7. 179137Species Pseudomonas putida [TaxId:303] [52535] (1 PDB entry)
  8. 179138Domain d1qs0a1: 1qs0 A: [31829]
    Other proteins in same PDB: d1qs0b2

Details for d1qs0a1

PDB Entry: 1qs0 (more details), 2.4 Å

PDB Description: Crystal Structure of Pseudomonas Putida 2-oxoisovalerate Dehydrogenase (Branched-Chain Alpha-Keto Acid Dehydrogenase, E1B)

SCOP Domain Sequences for d1qs0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qs0a1 c.36.1.3 (A:) 2-oxoisovalerate dehydrogenase, E1B {Pseudomonas putida}
neyaplrlhvpeptgrpgcqtdfsylrlndagqarkppvdvdaadtadlsyslvrvldeq
gdaqgpwaedidpqilrqgmramlktrifdsrmvvaqrqkkmsfymqslgeeaigsgqal
alnrtdmcfptyrqqsilmardvslvemicqllsnerdplkgrqlpimysvreagfftis
gnlatqfvqavgwamasaikgdtkiasawigdgataesdfhtaltfahvyrapvilnvvn
nqwaistfqaiaggesttfagrgvgcgiaslrvdgndfvavyaasrwaaerarrglgpsl
iewvtyragphstsddpskyrpaddwshfplgdpiarlkqhlikighwseeehqattaef
eaaviaaqkeaeqygtlanghipsaasmfedvykempdhlrrqrqel

SCOP Domain Coordinates for d1qs0a1:

Click to download the PDB-style file with coordinates for d1qs0a1.
(The format of our PDB-style files is described here.)

Timeline for d1qs0a1: