SCOPe 2.08: Domain d5l3sc2: 5l3s C:88-292

Lineage for d5l3sc2 (5l3s C:88-292)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein automated matches [190304] (16 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:273057] [318285] (1 PDB entry)

8. Domain d5l3sc2: 5l3s C:88-292 [318286]
   Other proteins in same PDB: d5l3sa1, d5l3sc1, d5l3se1, d5l3sg1
   automated match to d1qzxa3
   complexed with g, gnp, gol, mg, so4

Details for d5l3sc2

PDB Entry: 5l3s, 1.9 Å

PDB Description: structure of the gtpase heterodimer of crenarchaeal srp54 and ftsy

PDB Compounds: (C:) Signal recognition particle 54 kDa protein

SCOPe Domain Sequences for d5l3sc2:

Sequence; same for both SEQRES and ATOM records:

>d5l3sc2 c.37.1.10 (C:88-292) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
pnvnptklpfiimlvgvqgsgktttagklayfykkrgykvglvaadvyrpaaydqllqlg
nqigvqvygepnnqnpieiakkgvdifvknkmdiiivdtagrhgygeetklleemkemyd
vlkpddvilvidasigqkaydlasrfhqaspigsviitkmdgtakgggalsavvatgati
kfigtgekideletfnakrfvsril

Timeline for d5l3sc2:

• d5l3sc2 first appeared in SCOPe 2.06
  
• d5l3sc2 appears in SCOPe 2.07